1. Signaling Pathways
  2. Metabolic Enzyme/Protease
  3. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-108321
    Zofenopril
    Inhibitor 98.81%
    Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril
  • HY-116023
    Moveltipril
    Inhibitor 99.89%
    Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.
    Moveltipril
  • HY-118472S
    Benazeprilat-d5
    Benazeprilat-d5 is the deuterium labeled Benazeprilat.
    Benazeprilat-d<sub>5</sub>
  • HY-A0230A
    Spirapril hydrochloride
    Inhibitor 99.2%
    Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure.
    Spirapril hydrochloride
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-A0115R
    Ramiprilat (Standard)
    Inhibitor
    Alvimopan (dihydrate) (Standard) is the analytical standard of Alvimopan (dihydrate). This product is intended for research and analytical applications. Alvimopan dihydrate (ADL 8-2698 dihydrate) is a potent, selective, orally active and reversible μ-opioid receptor antagonist, with an IC50 of 1.7 nM. Alvimopan dihydrate has selectivity for μ-opioid receptor (Ki=0.47 nM) over κ- and δ-opioid receptors (Kis=100, 12 nM, respectively). Alvimopan dihydrate can be used for the research of postoperative ileus.
    Ramiprilat (Standard)
  • HY-P3985
    Bradykinin potentiator B
    Inhibitor 99.94%
    Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.
    Bradykinin potentiator B
  • HY-RS00152
    ACE2 Human Pre-designed siRNA Set A
    Inhibitor

    ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    ACE2 Human Pre-designed siRNA Set A
  • HY-142578S
    Perindoprilat-d4
    Inhibitor 98.06%
    Perindoprilat-d4 is the deuterium labeled Perindoprilat.
    Perindoprilat-d<sub>4</sub>
  • HY-P0318
    Hemorphin-7
    Inhibitor
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-N0214A
    Peimisine hydrochloride
    Inhibitor 99.34%
    Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research.
    Peimisine hydrochloride
  • HY-106446
    Rentiapril
    Inhibitor 99.59%
    Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity.
    Rentiapril
  • HY-A0116
    Trandolaprilate
    Inhibitor 99.42%
    Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.
    Trandolaprilate
  • HY-P10601A
    αs1-CN f(143–149) acetate
    Inhibitor 99.32%
    αs1-CN f(143–149) acetate is an orally active casein-derived peptide sequence. αs1-CN f(143–149) acetate exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC50=6.58 μM) and antihypertensive activity.
    αs1-CN f(143–149) acetate
  • HY-N8018
    Leucosceptoside A
    Inhibitor
    Leucosceptoside A is a phenylethanoid glycoside with anti-hyperglycemic and anti-hypertensive activities. Leucosceptoside A shows inhibitory activity against α-glucosidase and PKCα (IC50 of 19.0 μM).
    Leucosceptoside A
  • HY-108321S
    Zofenopril-d5
    Inhibitor 99.92%
    Zofenopril-d5 is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril-d<sub>5</sub>
  • HY-W342283
    Diminazene
    Activator
    Diminazene is an antiparasitic agent widely used to treat parasitic diseases caused by hemoparasites (such as trypanosomes and babesia). Diminazene acts as an ACE2 activator and exerts cardiovascular protective effects by activating the ACE2/Ang-(1-7)/Mas receptor axis. By regulating gut microbiota-tryptophan metabolism, Diminazene inhibits the activation of core inflammatory signaling pathways including MAPK, STAT and NF-κB, increases central 5-HT levels, and suppresses splenic TNF-α production, thereby alleviating systemic inflammation.
    Diminazene
  • HY-N7450
    Icariside D2
    Inhibitor 98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-U00041
    Pivalopril
    Inhibitor 99.19%
    Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.
    Pivalopril
  • HY-P3976
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
    Inhibitor 99.78%
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure.
    Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity